FXYD4 (NM_001184963) Human Tagged ORF Clone
CAT#: RC229519
- TrueORF®
FXYD4 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 4 (FXYD4), transcript variant 2
"NM_001184963" in other vectors (4)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | FXYD4 |
Synonyms | CHIF |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC229519 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAGAGTGACCCTGGCCCTTCTCCTACTGGCAGGCCTGACTGCCTTGGAAGCCAATGACCCATTTG CCAATAAAGACGATCCCTTCTACTATGACTGGAAAAACCTGCAGCTGAGCGGACTGATCTGCGGAGGGCT CCTGGCCATTGCTGGGATCGCGGCAGTTCTGAGTGGCAAATGCAAATGCAAGAGCAGCCAGAAGCAGCAC AGTCCTGTACCTGAGAAGGCCATCCCACTCATCACTCCAGGCTCTGCCACTACTTGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC229519 protein sequence
Red=Cloning site Green=Tags(s) MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH SPVPEKAIPLITPGSATTC myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
![]() Sequencher program is needed, download here. |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_001184963 |
ORF Size | 267 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001184963.1, NP_001171892.1 |
RefSeq Size | 636 bp |
RefSeq ORF | 270 bp |
Locus ID | 53828 |
Protein Families | Ion Channels: Other, Transmembrane |
MW | 9.4 kDa |
Gene Summary | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found. [provided by RefSeq, May 2010] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC328157 | FXYD4 (untagged)-Human FXYD domain containing ion transport regulator 4 (FXYD4) transcript variant 2 |
USD 420.00 |
|
RG229519 | FXYD4 (GFP-tagged) - Human FXYD domain containing ion transport regulator 4 (FXYD4), transcript variant 2 |
USD 460.00 |
|
RC229519L3 | Lenti-ORF clone of FXYD4 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 4 (FXYD4), transcript variant 2 |
USD 620.00 |
|
RC229519L4 | Lenti-ORF clone of FXYD4 (mGFP-tagged)-Human FXYD domain containing ion transport regulator 4 (FXYD4), transcript variant 2 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review