FXYD4 (NM_001184963) Human Tagged ORF Clone

CAT#: RG229519

  • TrueORF®

FXYD4 (GFP-tagged) - Human FXYD domain containing ion transport regulator 4 (FXYD4), transcript variant 2


  "NM_001184963" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "FXYD4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol FXYD4
Synonyms CHIF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG229519 representing NM_001184963
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGAGTGACCCTGGCCCTTCTCCTACTGGCAGGCCTGACTGCCTTGGAAGCCAATGACCCATTTG
CCAATAAAGACGATCCCTTCTACTATGACTGGAAAAACCTGCAGCTGAGCGGACTGATCTGCGGAGGGCT
CCTGGCCATTGCTGGGATCGCGGCAGTTCTGAGTGGCAAATGCAAATGCAAGAGCAGCCAGAAGCAGCAC
AGTCCTGTACCTGAGAAGGCCATCCCACTCATCACTCCAGGCTCTGCCACTACTTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG229519 representing NM_001184963
Red=Cloning site Green=Tags(s)

MERVTLALLLLAGLTALEANDPFANKDDPFYYDWKNLQLSGLICGGLLAIAGIAAVLSGKCKCKSSQKQH
SPVPEKAIPLITPGSATTC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001184963
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001184963.1, NP_001171892.1
RefSeq Size 636
RefSeq ORF 270
Locus ID 53828
Protein Families Ion Channels: Other, Transmembrane
Gene Summary This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD4, originally named CHIF for channel-inducing factor, has been shown to modulate the properties of the Na,K-ATPase, as has FXYD2, also known as the gamma subunit of the Na,K-ATPase, and FXYD7. Transmembrane topology has been established for FXYD4 and two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Alternatively spliced transcript variants encoding the same protein have been found. [provided by RefSeq, May 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.