ELOVL5 (NM_001242831) Human Tagged ORF Clone

CAT#: RC231598

  • TrueORF®

ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 4


  "NM_001242831" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "ELOVL5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ELOVL5
Synonyms dJ483K16.1; HELO1; SCA38
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231598 representing NM_001242831
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACATTTTGATGCATCACTTAGTACCTATTTCAAGGCATTGCTAGGCCCTCGAGGTATCAGCAGCT
CTGTCCTCAGAATGGGTCCCCCACTTCACACAGTTGTAGGATGGCTACAGCAGCTCCAAGCAGCACATTC
AGAGGAAGAAGAAAAAATGTTTCATTTGTGTGGTTTTAAGCATAAAGAAGTTGTTTCCCAGAGCTCTTTG
CCAGCTGTCATCCCTCAAAACTCACTGGCCACAATTGCTTCACATGCCCCTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231598 representing NM_001242831
Red=Cloning site Green=Tags(s)

MEHFDASLSTYFKALLGPRGISSSVLRMGPPLHTVVGWLQQLQAAHSEEEEKMFHLCGFKHKEVVSQSSL
PAVIPQNSLATIASHAPA

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001242831
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001242831.1, NP_001229760.1
RefSeq Size 849
RefSeq ORF 267
Locus ID 60481
Protein Families Transmembrane
Protein Pathways Biosynthesis of unsaturated fatty acids
MW 10 kDa
Gene Summary This gene belongs to the ELO family. It is highly expressed in the adrenal gland and testis, and encodes a multi-pass membrane protein that is localized in the endoplasmic reticulum. This protein is involved in the elongation of long-chain polyunsaturated fatty acids. Mutations in this gene have been associated with spinocerebellar ataxia-38 (SCA38). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.