RAD54B (NM_001205262) Human Tagged ORF Clone

CAT#: RC231696

RAD54B (Myc-DDK tagged) - Homo sapiens RAD54 homolog B (S. cerevisiae) (RAD54B), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: RAD54B
• Synonyms: RDH54
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC231696 representing NM_001205262
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGACGATCTGCAGCACCAAGTCAGTTGCAGGGGAATTCCTTCAAAAAACCAAAATTTATACCTCCAG
  GAAGAAGTAATCCAGGTCTGAATGAAGAGATTACAAAACTGAATCCAGATATAAAATTATTTGAGGGTGT
  TGCAATTAATAACACCTTTCTCCCGTCACAAAATGATCTTAGAATATGCAGTTTAAATCTGCCTAGTGAA
  GAAAGTACTAGAGAAATCAATAACAGAGATAATTGCAGTGGAAAATATTGTTTTGAAGCACCTACACTGG
  CAACATTAGATCCACCTCATACAGTGCAAACTTGGATGAGGAGGCACAGGCTGGTACCAGTTCACTACAG
  G
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC231696 representing NM_001205262
  Red=Cloning site Green=Tags(s)
  
  MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDLRICSLNLPSE
  ESTREINNRDNCSGKYCFEAPTLATLDPPHTVQTWMRRHRLVPVHYR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001205262
• ORF Size: 351 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001205262.1, NM_001205262.2, NP_001192191.1
• RefSeq Size: 5380
• RefSeq ORF: 354
• Locus ID: 25788
• Protein Families: Druggable Genome
• Protein Pathways: Homologous recombination
• MW: 13.8 kDa
• Gene Summary: The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]