SEC11A (NM_001271921) Human Tagged ORF Clone

CAT#: RC231749

  • TrueORF®

SEC11A (Myc-DDK tagged) - Homo sapiens SEC11 homolog A (S. cerevisiae) (SEC11A), transcript variant 1


  "NM_001271921" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "SEC11A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEC11A
Synonyms 1810012E07Rik; SEC11L1; sid2895; SPC18; SPCS4A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231749 representing NM_001271921
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTCTAGACTTTTTGGACGATGTGCGGCGGATGAACAAGCGGCAGCTCTATTATCAAGTCCTAA
ATTTTGGAATGATTGTCTCATCGGCACTAATGATCTGGAAGGGGTTAATGGTAATAACTGGAAGTGAAAG
TCCGATTGTAGTGGTGCTCAGGCAAAATGGGCATATCAAGTTTTTGACCAAAGGAGATAATAATGCGGTT
GATGACCGAGGCCTCTATAAACAAGGACAACATTGGCTAGAGAAAAAAGATGTTGTGGGGAGAGCCAGGG
GATTTGTTCCTTATATTGGAATTGTGACGATCCTCATGAATGACTATCCTAAATTTAAGTATGCAGTTCT
CTTTTTGCTGGGTTTATTCGTGCTGGTTCATCGTGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231749 representing NM_001271921
Red=Cloning site Green=Tags(s)

MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLRQNGHIKFLTKGDNNAV
DDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271921
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001271921.1, NP_001258850.1
RefSeq Size 1274
RefSeq ORF 390
Locus ID 23478
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Protein export
MW 15.3 kDa
Gene Summary This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. [provided by RefSeq, Dec 2012]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.