PEA15 (NM_001297578) Human Tagged ORF Clone

CAT#: RC235669

PEA15 (myc-DDK-tagged) - Human phosphoprotein enriched in astrocytes 15 (PEA15), transcript variant 4

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: PEA15
• Synonyms: HMAT1; HUMMAT1H; MAT1; MAT1H; PEA-15; PED; PED-PEA15; PED/PEA15
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC235669 representing NM_001297578
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTGAGTACGGGACCCTCCTGCAAGACCTGACCAACAACATCACCCTTGAAGATCTAGAACAGCTCA
  AGTCGGCCTGCAAGGAAGACATCCCCAGCGAAAAGAACAACCTCTCCTACATTGAGCACATCTTTGAGAT
  CTCCCGCCGTCCTGACCTACTCACTATGGTGGTTGACTACAGAACCCGTGTGCTGAAGATCTCTGAGGAG
  GATGAGCTGGACACCAAGCTAACCCGTATCCCCAGTGCCAAGAAGTACAAAGACATTATCCGGCAGCCCT
  CTGAGGAAGAGATCATCAAATTGGCTCCCCCACCGAAGAAGGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC235669 representing NM_001297578
  Red=Cloning site Green=Tags(s)
  
  MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKNNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEE
  DELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001297578
• ORF Size: 324 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001297578.1, NP_001284507.1
• RefSeq Size: 2443
• RefSeq ORF: 327
• Locus ID: 8682
• Protein Families: Druggable Genome
• MW: 13 kDa
• Gene Summary: This gene encodes a death effector domain-containing protein that functions as a negative regulator of apoptosis. The encoded protein is an endogenous substrate for protein kinase C. This protein is also overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]