Eph receptor A7 (EPHA7) (NM_001288630) Human Tagged ORF Clone

CAT#: RC237135

  • TrueORF®

EPHA7 (myc-DDK-tagged) - Human EPH receptor A7 (EPHA7), transcript variant 3


  "NM_001288630" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "EPHA7"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol EPHA7
Synonyms EHK-3; EHK3; EK11; HEK11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC237135 representing NM_001288630
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTTTCAAACTCGGTACCCTTCATGGATTATTTTATGCTACATCTGGCTGCTCCGCTTTGCACACA
CAGGGGAGGCGCAGGCTGCGAAGGAAGTACTACTGCTGGATTCTAAAGCACAACAAACAGAGTTGGAGTG
GATTTCCTCTCCACCCAATGGGTGGGAAGAAATTAGTGGTTTGGATGAGAACTATACCCCGATACGAACA
TACCAGGTGTGCCAAGTCATGGAGCCCAACCAAAACAACTGGCTGCGGACTAACTGGATTTCCAAAGGCA
ATGCACAAAGGATTTTTGTAGAATTGAAATTCACCCTGAGGGATTGTAACAGTCTTCCTGGAGTACTGGG
AACTTGCAAGGAAACATTTAATTTGTACTATTATGAAACAGACTATGACACTGGCAGGAATATAAGAGAA
AACCTCTATGTAAAAATAGACACCATTGCTGCAGATGAAAGTTTTACCCAAGGTGACCTTGGTGAAAGAA
AGATGAAGCTTAACACTGAGGTGAGAGAGATTGGACCTTTGTCCAAAAAGGGATTCTATCTTGCCTTTCA
GGATGTAGGGGCTTGCATAGCTTTGGTTTCTGTCAAAGTGTACTACAAGAAGTGCTGGTCCATTATTGAG
AACTTAGCTATCTTTCCAGATACAGTGACTGGTTCAGAATTTTCCTCTTTAGTCGAGGTTCGAGGGACAT
GTGTCAGCAGTGCAGAGGAAGAAGCGGAAAACGCCCCCAGGATGCACTGCAGTGCAGAAGGAGAATGGTT
AGTGCCCATTGGAAAATGTATCTGCAAAGCAGGCTACCAGCAAAAAGGAGACACTTGTGAACGTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC237135 representing NM_001288630
Red=Cloning site Green=Tags(s)

MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRT
YQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRE
NLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIE
NLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCERK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001288630
ORF Size 837 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001288630.1, NP_001275559.1
RefSeq Size 1935 bp
RefSeq ORF 840 bp
Locus ID 2045
Cytogenetics 6q16.1
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Axon guidance
MW 32.3 kDa
Gene Summary 'This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.