CAMKK2 (NM_172226) Human Tagged ORF Clone
CAT#: RG203468
- TrueORF®
CAMKK2 (GFP-tagged) - Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7
"NM_172226" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | CAMKK2 |
Synonyms | CAMKK; CAMKKB |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG203468 representing NM_172226
Red=Cloning site Green=Tags(s) MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR DRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM IRKRSFGNPFEGSRREERSLSAPGNLLTKQGSEDNLQGTDPPPVGEEEVLL TRTRRLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_172226 |
ORF Size | 1623 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Reference Data | |
RefSeq | NM_172226.2, NP_757380.1 |
RefSeq Size | 4923 |
RefSeq ORF | 1626 |
Locus ID | 10645 |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Adipocytokine signaling pathway |
MW | 59.6 kDa |
Gene Summary | The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. The major isoform of this gene plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Protein products of this gene also phosphorylate AMP-activated protein kinase (AMPK). This gene has its strongest expression in the brain and influences signalling cascades involved with learning and memory, neuronal differentiation and migration, neurite outgrowth, and synapse formation. Alternative splicing results in multiple transcript variants encoding distinct isoforms. The identified isoforms differ in their ability to undergo autophosphorylation and to phosphorylate downstream kinases. [provided by RefSeq, Jul 2012] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC110186 | CAMKK2 (untagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 |
USD 310.00 |
|
RC203468 | CAMKK2 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 |
USD 420.00 |
|
RC203468L1 | Lenti-ORF clone of CAMKK2 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 |
USD 768.00 |
|
RC203468L2 | Lenti-ORF clone of CAMKK2 (mGFP-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 |
USD 620.00 |
|
RC203468L3 | Lenti-ORF clone of CAMKK2 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 |
USD 620.00 |
|
RC203468L4 | Lenti-ORF clone of CAMKK2 (mGFP-tagged)-Human calcium/calmodulin-dependent protein kinase kinase 2, beta (CAMKK2), transcript variant 7 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review