BAD (NM_032989) Human Tagged ORF Clone

CAT#: RG210630

  • TrueORF®

BAD (GFP-tagged) - Human BCL2-associated agonist of cell death (BAD), transcript variant 2


  "NM_032989" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol BAD
Synonyms BBC2; BCL2L8
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG210630 representing NM_032989
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCAGATCCCAGAGTTTGAGCCGAGTGAGCAGGAAGACTCCAGCTCTGCAGAGAGGGGCCTGGGCC
CCAGCCCCGCAGGGGACGGGCCCTCAGGCTCCGGCAAGCATCATCGCCAGGCCCCAGGCCTCCTGTGGGA
CGCCAGTCACCAGCAGGAGCAGCCAACCAGCAGCAGCCATCATGGAGGCGCTGGGGCTGTGGAGATCCGG
AGTCGCCACAGCTCCTACCCCGCGGGGACGGAGGACGACGAAGGGATGGGGGAGGAGCCCAGCCCCTTTC
GGGGCCGCTCGCGCTCGGCGCCCCCCAACCTCTGGGCAGCACAGCGCTATGGCCGCGAGCTCCGGAGGAT
GAGTGACGAGTTTGTGGACTCCTTTAAGAAGGGACTTCCTCGCCCGAAGAGCGCGGGCACAGCAACGCAG
ATGCGGCAAAGCTCCAGCTGGACGCGAGTCTTCCAGTCCTGGTGGGATCGGAACTTGGGCAGGGGAAGCT
CCGCCCCCTCCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210630 representing NM_032989
Red=Cloning site Green=Tags(s)

MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIR
SRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQ
MRQSSSWTRVFQSWWDRNLGRGSSAPSQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_032989
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_032989.1, NP_116784.1
RefSeq Size 956 bp
RefSeq ORF 507 bp
Locus ID 572
Cytogenetics 11q13.1
Protein Families Druggable Genome
Protein Pathways Acute myeloid leukemia, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Insulin signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Prostate cancer, VEGF signaling pathway
Gene Summary 'The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform. [provided by RefSeq, Dec 2019]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.