FOXP1 (NM_001012505) Human Tagged ORF Clone

CAT#: RG216342

  • TrueORF®

FOXP1 (GFP-tagged) - Human forkhead box P1 (FOXP1), transcript variant 2


  "NM_001012505" in other vectors (4)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "FOXP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol FOXP1
Synonyms 12CC4; hFKH1B; HSPC215; MFH; QRF1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG216342 representing NM_001012505
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCA
ACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGG
GGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGTGGCATCTCATAAACCATCAGCCCTCTAGG
AGTCCCAGCAGTTGGCTTAAGAGACTAATTTCAAGCCCTTGGGAGTTGGAAGTCCTGCAGGTCCCCTTGT
GGGGAGCAGTTGCTGAGACGAAGATGAGTGGACCTGTGTGTCAGCCTAACCCTTCCCCATTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216342 representing NM_001012505
Red=Cloning site Green=Tags(s)

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSR
SPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001012505
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001012505.1, NP_001012523.1
RefSeq Size 937 bp
RefSeq ORF 345 bp
Locus ID 27086
Cytogenetics 3p13
Protein Families Transcription Factors
Gene Summary This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.