ACYP1 (NM_203488) Human Tagged ORF Clone

CAT#: RG218256

  • TrueORF®

ACYP1 (GFP-tagged) - Human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 2


  "NM_203488" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "ACYP1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ACYP1
Synonyms ACYPE
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG218256 representing NM_203488
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAAGGAAACACCCTGATATCAGTGGATTATGAAATTTTTGGGAAGGTGCAAGGGGTGTTTTTCC
GTAAGCATACTCAGGAAATGACTGTTGAAAACAGAATTGCTGAAACTCACAGCAAGAGCTGTGTTCCAGT
TAGCTTTGCTACCAGTTATGCAGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG218256 representing NM_203488
Red=Cloning site Green=Tags(s)

MAEGNTLISVDYEIFGKVQGVFFRKHTQEMTVENRIAETHSKSCVPVSFATSYAG

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_203488
ORF Size 165 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_203488.1, NP_982355.1
RefSeq Size 700
RefSeq ORF 168
Locus ID 97
Protein Pathways Pyruvate metabolism
Gene Summary This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.