Growth Hormone (GH1) (NM_022562) Human Tagged ORF Clone
CAT#: RG219794
- TrueORF®
GH1 (GFP-tagged) - Human growth hormone 1 (GH1), transcript variant 5
"NM_022562" in other vectors (4)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | GH1 |
Synonyms | GH; GH-N; GHN; hGH-N; IGHD1B |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG219794 representing NM_022562
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTACAGAGGCTGGAAGATGGCAGCCCCCGGACTGGGCAGATCTTCAAGCAGACCTACAGCAAGTTC GACACAAACTCACACAACGA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG219794 representing NM_022562
Red=Cloning site Green=Tags(s) MATEAGRWQPPDWADLQADLQQVRHKLTQR TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_022562 |
ORF Size | 90 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_022562.2, NP_072056.1 |
RefSeq Size | 376 bp |
RefSeq ORF | 93 bp |
Locus ID | 2688 |
Cytogenetics | 17q23.3 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Gene Summary | 'The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC305033 | GH1 (untagged)-Human growth hormone 1 (GH1), transcript variant 5 |
USD 420.00 |
|
RC219794 | GH1 (Myc-DDK-tagged)-Human growth hormone 1 (GH1), transcript variant 5 |
USD 420.00 |
|
RC219794L3 | Lenti-ORF clone of GH1 (Myc-DDK-tagged)-Human growth hormone 1 (GH1), transcript variant 5 |
USD 620.00 |
|
RC219794L4 | Lenti-ORF clone of GH1 (mGFP-tagged)-Human growth hormone 1 (GH1), transcript variant 5 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review