Mt3 (NM_053968) Rat Tagged ORF Clone

CAT#: RR205870

Mt3 (Myc-DDK-tagged ORF) - Rat metallothionein 3 (Mt3), (10 ug)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Mt3
• Synonyms: GIF; Mt-3
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR205870 representing NM_053968
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACCCTGAGACCTGCCCCTGTCCTACTGGTGGTTCCTGCACCTGCTCGGACAAATGCAAATGCAAGG
  GCTGCAAATGCACGAACTGCAAGAAGAGCTGCTGCTCCTGTTGCCCTGCAGGATGTGAGAAGTGTGCCAA
  GGACTGTGTTTGCAAAGGCGAAGAGGGGGCCAAGGCCGAGAAATGCAGCTGCTGCCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR205870 representing NM_053968
  Red=Cloning site Green=Tags(s)
  
  MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEKCSCCQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_053968
• ORF Size: 198 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_053968.1, NM_053968.2, NM_053968.3, NP_446420.1
• RefSeq Size: 405
• RefSeq ORF: 201
• Locus ID: 117038
• MW: 6.8 kDa
• Gene Summary: heavy metal binding protein; acts as an inhibitor of neurite sprouting and deficiency may play a role in Alzheimer's disease [RGD, Feb 2006]