Fxyd5 (NM_001270689) Rat Tagged ORF Clone

CAT#: RR215966

Fxyd5 (myc-DDK-tagged) - Rat FXYD domain-containing ion transport regulator 5 (Fxyd5), transcript variant 3

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Fxyd5
• Synonyms: RIC
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR215966 representing NM_001270689
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCACCGCCCAGTCAGCTGTGTCTCCTCACCATTGTCGCCCTGATTCTGCCTAGTGAAGGGCAGACAC
  CAGAAAAACCCAGATCCAGTTTTACAGCGCACCAGAGTTCTGTGACTACTCATGTCCCAGTTCCAGATCA
  AACCAGCCCAGGAGTCCAGACCACTCCTCCCATCTGGACCAGTGAAGCTGGCGAAGCCACAGGAAGCCAG
  ACAGCAGCCAAAACCAAGACCCAGCAACTGACCGAAATGGCCACTGCGAATCCAGTGACAGATCCAGGGC
  CACTTACAAGCAGCGAGAAAGGTACCCCGGCACTCTCCAGGATCAAATCTCCCAGCCCACCCAAAGGTTA
  CATGCCTCCATCCTACATTGAGAATCCACTGGATCCCAATGAGAACAGCCCCTTCTACTACGACAATACC
  ACCCTCCGGAAACGGGGGCTGCTGGTGGCGGCAGTGCTGTTCATTACTGGAATTATCATCCTCACTAGTG
  GGAAGTGTAGACAGTTCTCTCAGTTATGCCTGAATCGCCACAGG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR215966 representing NM_001270689
  Red=Cloning site Green=Tags(s)
  
  MSPPSQLCLLTIVALILPSEGQTPEKPRSSFTAHQSSVTTHVPVPDQTSPGVQTTPPIWTSEAGEATGSQ
  TAAKTKTQQLTEMATANPVTDPGPLTSSEKGTPALSRIKSPSPPKGYMPPSYIENPLDPNENSPFYYDNT
  TLRKRGLLVAAVLFITGIIILTSGKCRQFSQLCLNRHR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001270689
• ORF Size: 534 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001270689.1, NP_001257618.1
• RefSeq Size: 854
• RefSeq ORF: 537
• Locus ID: 60338
• MW: 19.1 kDa
• Gene Summary: This reference sequence was derived from multiple replicate ESTs and validated by similar mouse cDNA sequence and human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. Three transcript variants encoding the same protein have been found for this gene. [RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu., Dec 2000]