CDK7 (NM_001799) Human Mutant ORF Clone

CAT#: RC402573

CDK7 Mutant (Q123X), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase 7 (CDK7) as transfection-ready DNA

Specifications

Product Data

• Mutation Description: Q123X
• Affected Codon#: 123
• Affected NT#: 367
• Tag: Myc-DDK
• Effect: Poenil proein defiieny
• Symbol: CDK7
• Synonyms: CAK; CAK1; CDKN7; HCAK; MO15; p39MO15; STK1
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Vector: pCMV6-Entry
• ACCN: NM_001799
• ORF Size: 366 bp
• Sequence Data:
  ORF Nucleotide Sequence

  >RC402573 representing NM_001799
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTCTGGACGTGAAGTCTCGGGCAAAGCGTTATGAGAAGCTGGACTTCCTTGGGGAGGGACAGTTTG
  CCACCGTTTACAAGGCCAGAGATAAGAACACCAACCAAATTGTCGCCATTAAGAAAATCAAACTTGGACA
  TAGATCAGAAGCTAAAGATGGTATAAATAGAACCGCCTTAAGAGAGATAAAATTATTACAGGAGCTAAGT
  CATCCAAATATAATTGGTCTCCTTGATGCTTTTGGACATAAATCTAATATTAGCCTTGTCTTTGATTTTA
  TGGAAACTGATCTAGAGGTTATAATAAAGGATAATAGTCTTGTGCTGACACCATCACACATCAAAGCCTA
  CATGTTGATGACTCTT
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGA TAAGGTTTAA
  Protein Sequence

  >RC402573 representing NM_001799
  Red=Cloning site Green=Tags(s)
  
  MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS
  HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTL
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NP_001790
• RefSeq Size: 366 bp
• RefSeq ORF: 1041 bp
• Locus ID: 1022
• Cytogenetics: 5q13.2
• Domains: pkinase, TyrKc, S_TKc
• Protein Families: Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cell cycle, Nucleotide excision repair
• MW: 13.4 kDa
• Gene Summary: 'The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008]'