14 3 3 eta (YWHAH) (NM_003405) Human Mass Spec Standard

CAT#: PH300013

YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396)

Product Images

Coomassie blue staining of purified YWHAH protein (Cat# TP300013). The protein was produced from HEK293T cells transfected with YWHAH cDNA clone (Cat# RC200013) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200013
• Predicted MW: 28.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200013 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT
  MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG
  EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT
  LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003396
• RefSeq Size: 1807
• RefSeq ORF: 738
• Synonyms: YWHA1
• Locus ID: 7533
• UniProt ID: Q04917, A0A024R1K7, Q9H4N8
• Cytogenetics: 22q12.3
• Summary: 'This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009]'
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis