14 3 3 eta (YWHAH) (NM_003405) Human Recombinant Protein

CAT#: TP300013

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Product Images

Coomassie blue staining of purified YWHAH protein (Cat# TP300013). The protein was produced from HEK293T cells transfected with YWHAH cDNA clone (Cat# RC200013) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200013 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT
  MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG
  EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT
  LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003396
• Locus ID: 7533
• UniProt ID: Q04917, A0A024R1K7, Q9H4N8
• Cytogenetics: 22q12.3
• Refseq Size: 1807
• Refseq ORF: 738
• Synonyms: YWHA1
• Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis