GAL4 (LGALS4) (NM_006149) Human Mass Spec Standard

CAT#: PH300026

LGALS4 MS Standard C13 and N15-labeled recombinant protein (NP_006140)

Product Images

Coomassie blue staining of purified LGALS4 protein (Cat# TP300026). The protein was produced from HEK293T cells transfected with LGALS4 cDNA clone (Cat# RC200026) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200026
• Predicted MW: 35.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200026 representing NM_006149
  Red=Cloning site Green=Tags(s)
  
  MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG
  WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG
  DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII
  KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC
  GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006140
• RefSeq Size: 1117
• RefSeq ORF: 969
• Synonyms: GAL4; L36LBP
• Locus ID: 3960
• UniProt ID: P56470, Q6FHZ4
• Cytogenetics: 19q13.2
• Summary: 'The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. [provided by RefSeq, Jul 2008]'