NFYC (NM_014223) Human Mass Spec Standard

CAT#: PH300060

NFYC MS Standard C13 and N15-labeled recombinant protein (NP_055038)

Product Images

Coomassie blue staining of purified NFYC protein (Cat# TP300060). The protein was produced from HEK293T cells transfected with NFYC cDNA clone (Cat# RC200060) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200060
• Predicted MW: 37.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200060 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFA
  KAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAE
  PVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQG
  QAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQT
  EVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055038
• RefSeq Size: 2105
• RefSeq ORF: 1005
• Synonyms: CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC
• Locus ID: 4802
• UniProt ID: Q13952
• Cytogenetics: 1p34.2
• Summary: 'This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]'
• Protein Families: Transcription Factors
• Protein Pathways: Antigen processing and presentation