NFYC (NM_001142589) Human Mass Spec Standard
CAT#: PH326680
NFYC MS Standard C13 and N15-labeled recombinant protein (NP_001136061)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226680 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC226680 representing NM_001142589
Red=Cloning site Green=Tags(s) MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKRNDIAMAITKF DQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQI IIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQL QYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFI QSANQPSDGQAPQVTGD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001136061 |
RefSeq ORF | 891 |
Synonyms | CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC |
Locus ID | 4802 |
UniProt ID | Q13952 |
Cytogenetics | 1p34.2 |
Summary | 'This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]' |
Protein Families | Transcription Factors |
Protein Pathways | Antigen processing and presentation |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402291 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428190 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428191 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428192 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428193 | NFYC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402291 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 2 |
USD 396.00 |
|
LY428190 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 3 |
USD 396.00 |
|
LY428191 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 1 |
USD 396.00 |
|
LY428192 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 4 |
USD 396.00 |
|
LY428193 | Transient overexpression lysate of nuclear transcription factor Y, gamma (NFYC), transcript variant 5 |
USD 396.00 |
|
PH300060 | NFYC MS Standard C13 and N15-labeled recombinant protein (NP_055038) |
USD 2,055.00 |
|
TP300060 | Recombinant protein of human nuclear transcription factor Y, gamma (NFYC), transcript variant 2 |
USD 823.00 |
|
TP326680 | Purified recombinant protein of Homo sapiens nuclear transcription factor Y, gamma (NFYC), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review