NTAL (LAT2) (NM_032463) Human Mass Spec Standard

CAT#: PH300102

LAT2 MS Standard C13 and N15-labeled recombinant protein (NP_115852)

Product Images

Coomassie blue staining of purified LAT2 protein (Cat# TP300102). The protein was produced from HEK293T cells transfected with LAT2 cDNA clone (Cat# RC200102) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200102
• Predicted MW: 26.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200102 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA
  DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL
  ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG
  QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115852
• RefSeq Size: 2129
• RefSeq ORF: 729
• Synonyms: HSPC046; LAB; NTAL; WBSCR5; WBSCR15; WSCR5
• Locus ID: 7462
• UniProt ID: Q9GZY6
• Cytogenetics: 7q11.23
• Summary: 'This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. [provided by RefSeq, Jul 2008]'
• Protein Families: Transmembrane