Germany
Japan
United Kingdom
China
NTAL (LAT2) (NM_032463) Human Recombinant Protein
CAT#: TP300102
Recombinant protein of human linker for activation of T cells family, member 2 (LAT2), transcript variant 2
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200102 protein sequence
Red=Cloning site Green=Tags(s) MSSGTELLWPGAALLVLLGVAASLCVRCSRPGAKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLA DMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVL ICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPTSGLCPSASPEEDEESEDYQNSASIHQWRESRKVMG QLQREASPGPVGSPDEEDGEPDYVNGEVAATEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 26.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115852 |
| Locus ID | 7462 |
| UniProt ID | Q9GZY6 |
| Cytogenetics | 7q11.23 |
| Refseq Size | 2129 |
| Refseq ORF | 729 |
| Synonyms | HSPC046; LAB; NTAL; WBSCR5; WBSCR15; WSCR5 |
| Summary | This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410097 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC410098 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC415475 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429810 | LAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY410097 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 2 |
USD 396.00 |
|
| LY410098 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 1 |
USD 396.00 |
|
| LY415475 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 3 |
USD 396.00 |
|
| LY429810 | Transient overexpression lysate of linker for activation of T cells family, member 2 (LAT2), transcript variant 1 |
USD 396.00 |
|
| PH300102 | LAT2 MS Standard C13 and N15-labeled recombinant protein (NP_115852) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
