Bif (SH3GLB1) (NM_016009) Human Mass Spec Standard

CAT#: PH300106

SH3GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_057093)

Product Images

Coomassie blue staining of purified SH3GLB1 protein (Cat# TP300106). The protein was produced from HEK293T cells transfected with SH3GLB1 cDNA clone (Cat# RC200106) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200106
• Predicted MW: 40.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200106 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN
  PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA
  LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR
  LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG
  SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG
  NQKGKVPITYLELLN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057093
• RefSeq Size: 6382
• RefSeq ORF: 1095
• Synonyms: Bif-1; CGI-61; dJ612B15.2; PPP1R70
• Locus ID: 51100
• UniProt ID: Q9Y371, A0A140VJU5
• Cytogenetics: 1p22.3
• Summary: This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Protein Pathways: Endocytosis