Bif (SH3GLB1) (NM_016009) Human Recombinant Protein

CAT#: TP300106

Recombinant protein of human SH3-domain GRB2-like endophilin B1 (SH3GLB1)

Product Images

Coomassie blue staining of purified SH3GLB1 protein (Cat# TP300106). The protein was produced from HEK293T cells transfected with SH3GLB1 cDNA clone (Cat# RC200106) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200106 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN
  PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA
  LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR
  LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG
  SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG
  NQKGKVPITYLELLN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 40.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057093
• Locus ID: 51100
• UniProt ID: Q9Y371, A0A140VJU5
• Cytogenetics: 1p22.3
• Refseq Size: 6382
• Refseq ORF: 1095
• Synonyms: Bif-1; CGI-61; dJ612B15.2; PPP1R70
• Summary: This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
• Protein Pathways: Endocytosis