CFAP298 (NM_021254) Human Mass Spec Standard

CAT#: PH300169

C21orf59 MS Standard C13 and N15-labeled recombinant protein (NP_067077)

Product Images

Coomassie blue staining of purified CFAP298 protein (Cat# TP300169). The protein was produced from HEK293T cells transfected with CFAP298 cDNA clone (Cat# RC200169) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200169
• Predicted MW: 33.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200169 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI
  EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK
  DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK
  NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH
  GVKDIKWRPR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_067077
• RefSeq Size: 1427
• RefSeq ORF: 870
• Synonyms: C21orf48; C21orf59; CILD26; FBB18; Kur
• Locus ID: 56683
• UniProt ID: P57076
• Cytogenetics: 21q22.11
• Summary: This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. [provided by RefSeq, Apr 2017]