CFAP298 (NM_021254) Human Recombinant Protein
CAT#: TP300169
Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200169 protein sequence
Red=Cloning site Green=Tags(s) MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH GVKDIKWRPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067077 |
Locus ID | 56683 |
UniProt ID | P57076 |
Cytogenetics | 21q22.11 |
Refseq Size | 1427 |
Refseq ORF | 870 |
Synonyms | C21orf48; C21orf59; CILD26; FBB18; Kur |
Summary | This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. [provided by RefSeq, Apr 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402864 | C21orf59 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402864 | Transient overexpression lysate of chromosome 21 open reading frame 59 (C21orf59) |
USD 396.00 |
|
PH300169 | C21orf59 MS Standard C13 and N15-labeled recombinant protein (NP_067077) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review