NDE1 (NM_017668) Human Mass Spec Standard
CAT#: PH300179
NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_060138)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200179 |
Predicted MW | 37.7 kDa |
Protein Sequence |
>RC200179 protein sequence
Red=Cloning site Green=Tags(s) MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_060138 |
RefSeq Size | 3222 |
RefSeq ORF | 1005 |
Synonyms | HOM-TES-87; LIS4; MHAC; NDE; NUDE; NUDE1 |
Locus ID | 54820 |
UniProt ID | Q9NXR1, X5DR54 |
Cytogenetics | 16p13.11 |
Summary | This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402606 | NDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428439 | NDE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402606 | Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2 |
USD 396.00 |
|
LY428439 | Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1 |
USD 396.00 |
|
PH327919 | NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_001137451) |
USD 2,055.00 |
|
TP300179 | Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2 |
USD 823.00 |
|
TP327919 | Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review