RPIP8 (RUNDC3A) (NM_006695) Human Mass Spec Standard

CAT#: PH300211

RUNDC3A MS Standard C13 and N15-labeled recombinant protein (NP_006686)

Product Images

Coomassie blue staining of purified RUNDC3A protein (Cat# TP300211). The protein was produced from HEK293T cells transfected with RUNDC3A cDNA clone (Cat# RC200211) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200211
• Predicted MW: 45.7 kDa
• Protein Sequence:
  Sequence Link

  >RC200211 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILS
  HRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSE
  YITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS
  YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLK
  DLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL
  NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006686
• RefSeq Size: 1879
• RefSeq ORF: 1215
• Synonyms: RAP2IP; RPIP-8; RPIP8
• Locus ID: 10900
• UniProt ID: Q59EK9
• Cytogenetics: 17q21.31
• Summary: May act as an effector of RAP2A in neuronal cells. [UniProtKB/Swiss-Prot Function]