RPIP8 (RUNDC3A) (NM_006695) Human Recombinant Protein

CAT#: TP300211

Recombinant protein of human RUN domain containing 3A (RUNDC3A), transcript variant 2

Product Images

Coomassie blue staining of purified RUNDC3A protein (Cat# TP300211). The protein was produced from HEK293T cells transfected with RUNDC3A cDNA clone (Cat# RC200211) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200211 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILS
  HRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSE
  YITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS
  YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLK
  DLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL
  NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006686
• Locus ID: 10900
• UniProt ID: Q59EK9
• Cytogenetics: 17q21.31
• Refseq Size: 1879
• Refseq ORF: 1215
• Synonyms: RAP2IP; RPIP-8; RPIP8
• Summary: May act as an effector of RAP2A in neuronal cells.[UniProtKB/Swiss-Prot Function]