ACAA1 (NM_001607) Human Mass Spec Standard

CAT#: PH300213

ACAA1 MS Standard C13 and N15-labeled recombinant protein (NP_001598)

Product Images

Coomassie blue staining of purified ACAA1 protein (Cat# TP300213). The protein was produced from HEK293T cells transfected with ACAA1 cDNA clone (Cat# RC200213) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200213
• Predicted MW: 44.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200213 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
  AVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG
  SYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA
  ARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSD
  GAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFAS
  QAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE
  YPGN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001598
• RefSeq Size: 1840
• RefSeq ORF: 1272
• Synonyms: ACAA; PTHIO; THIO
• Locus ID: 30
• UniProt ID: P09110, A0A024R2M6
• Cytogenetics: 3p22.2
• Summary: 'This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]'
• Protein Pathways: Biosynthesis of unsaturated fatty acids, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Valine, leucine and isoleucine degradation