ACAA1 (NM_001607) Human Recombinant Protein
CAT#: TP300213
Recombinant protein of human acetyl-Coenzyme A acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200213 protein sequence
Red=Cloning site Green=Tags(s) MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT AVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG SYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKA ARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSD GAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFAS QAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFE YPGN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001598 |
Locus ID | 30 |
UniProt ID | P09110, A0A024R2M6 |
Cytogenetics | 3p22.2 |
Refseq Size | 1840 |
Refseq ORF | 1272 |
Synonyms | ACAA; PTHIO; THIO |
Summary | This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008] |
Protein Pathways | Biosynthesis of unsaturated fatty acids, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway, Valine, leucine and isoleucine degradation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400605 | ACAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC427202 | ACAA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400605 | Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 1 (ACAA1), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 325.00 |
|
LY427202 | Transient overexpression lysate of acetyl-Coenzyme A acyltransferase 1 (ACAA1), transcript variant 2 |
USD 325.00 |
|
PH300213 | ACAA1 MS Standard C13 and N15-labeled recombinant protein (NP_001598) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review