RABL4 (IFT27) (NM_006860) Human Mass Spec Standard

CAT#: PH300215

RABL4 MS Standard C13 and N15-labeled recombinant protein (NP_006851)

Product Images

Coomassie blue staining of purified IFT27 protein (Cat# TP300215). The protein was produced from HEK293T cells transfected with IFT27 cDNA clone (Cat# RC200215) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200215
• Predicted MW: 20.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200215 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL
  FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA
  WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006851
• RefSeq Size: 1101
• RefSeq ORF: 558
• Synonyms: BBS19; RABL4; RAYL
• Locus ID: 11020
• UniProt ID: Q9BW83
• Cytogenetics: 22q12.3
• Summary: This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome