Sumo 3 (SUMO3) (NM_006936) Human Mass Spec Standard

CAT#: PH300241

SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867)

Product Images

Coomassie blue staining of purified SUMO3 protein (Cat# TP300241). The protein was produced from HEK293T cells transfected with SUMO3 cDNA clone (Cat# RC200241) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200241
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200241 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD
  TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008867
• RefSeq Size: 1831
• RefSeq ORF: 309
• Synonyms: SMT3A; Smt3B; SMT3H1; SUMO-3
• Locus ID: 6612
• UniProt ID: P55854
• Cytogenetics: 21q22.3
• Summary: 'This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]'
• Protein Families: Druggable Genome