Sumo 3 (SUMO3) (NM_006936) Human Recombinant Protein
CAT#: TP721152
Purified recombinant protein of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
|
Tag | Tag Free |
Predicted MW | 11.6 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_008867 |
Locus ID | 6612 |
UniProt ID | P55854 |
Cytogenetics | 21q22.3 |
Refseq Size | 1831 |
Refseq ORF | 309 |
Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3 |
Summary | 'This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402068 | SUMO3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402068 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
USD 325.00 |
|
PH300241 | SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867) |
USD 2,055.00 |
|
TP300241 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
USD 823.00 |
|
TP720508 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review