CLEC4E (NM_014358) Human Mass Spec Standard
CAT#: PH300244
CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200244 |
Predicted MW | 25.1 kDa |
Protein Sequence |
>RC200244 protein sequence
Red=Cloning site Green=Tags(s) MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI NPLNKGKSL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055173 |
RefSeq Size | 2158 |
RefSeq ORF | 657 |
Synonyms | CLECSF9; MINCLE |
Locus ID | 26253 |
UniProt ID | Q9ULY5 |
Cytogenetics | 12p13.31 |
Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415339 | CLEC4E HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415339 | Transient overexpression lysate of C-type lectin domain family 4, member E (CLEC4E) |
USD 325.00 |
|
TP300244 | Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E) |
USD 439.00 |
|
TP720695 | Purified recombinant protein of Human C-type lectin domain family 4, member E (CLEC4E) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review