CLEC4E (NM_014358) Human Recombinant Protein
CAT#: TP720695
Purified recombinant protein of Human C-type lectin domain family 4, member E (CLEC4E)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
RCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSLVDHHHHHH
|
Tag | C-His |
Predicted MW | 21.7 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055173 |
Locus ID | 26253 |
UniProt ID | Q9ULY5 |
Cytogenetics | 12p13.31 |
Refseq Size | 2158 |
Refseq ORF | 657 |
Synonyms | CLECSF9; MINCLE |
Summary | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415339 | CLEC4E HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415339 | Transient overexpression lysate of C-type lectin domain family 4, member E (CLEC4E) |
USD 325.00 |
|
PH300244 | CLEC4E MS Standard C13 and N15-labeled recombinant protein (NP_055173) |
USD 2,055.00 |
|
TP300244 | Recombinant protein of human C-type lectin domain family 4, member E (CLEC4E) |
USD 439.00 |
{0} Product Review(s)
Be the first one to submit a review