EB2 (MAPRE2) (NM_014268) Human Mass Spec Standard

CAT#: PH300259

MAPRE2 MS Standard C13 and N15-labeled recombinant protein (NP_055083)

Product Images

Coomassie blue staining of purified MAPRE2 protein (Cat# TP300259). The protein was produced from HEK293T cells transfected with MAPRE2 cDNA clone (Cat# RC200259) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200259
• Predicted MW: 37 kDa
• Protein Sequence:
  Sequence Link

  >RC200259 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDI
  VSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV
  KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSP
  AAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ
  EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055083
• RefSeq Size: 4279
• RefSeq ORF: 981
• Synonyms: CSCSC2; EB1; EB2; RP1
• Locus ID: 10982
• UniProt ID: Q15555, A0A024RC33
• Cytogenetics: 18q12.1-q12.2
• Summary: The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome