EB2 (MAPRE2) (NM_014268) Human Recombinant Protein

CAT#: TP300259

Recombinant protein of human microtubule-associated protein, RP/EB family, member 2 (MAPRE2), transcript variant 1

Product Images

Coomassie blue staining of purified MAPRE2 protein (Cat# TP300259). The protein was produced from HEK293T cells transfected with MAPRE2 cDNA clone (Cat# RC200259) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200259 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDI
  VSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLV
  KGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSP
  AAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQ
  EHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055083
• Locus ID: 10982
• UniProt ID: Q15555, A0A024RC33
• Cytogenetics: 18q12.1-q12.2
• Refseq Size: 4279
• Refseq ORF: 981
• Synonyms: CSCSC2; EB1; EB2; RP1
• Summary: The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. This protein is a microtubule-associated protein that is necessary for spindle symmetry during mitosis. It is thought to play a role in the tumorigenesis of colorectal cancers and the proliferative control of normal cells. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
• Protein Families: Druggable Genome