Annexin A10 (ANXA10) (NM_007193) Human Mass Spec Standard

CAT#: PH300268

ANXA10 MS Standard C13 and N15-labeled recombinant protein (NP_009124)

Product Images

Coomassie blue staining of purified ANXA10 protein (Cat# TP300268). The protein was produced from HEK293T cells transfected with ANXA10 cDNA clone (Cat# RC200268) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200268
• Predicted MW: 37.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200268 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD
  MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ
  EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV
  FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI
  DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_009124
• RefSeq Size: 1447
• RefSeq ORF: 972
• Synonyms: ANX14
• Locus ID: 11199
• UniProt ID: Q9UJ72
• Cytogenetics: 4q32.3
• Summary: This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]