Annexin A10 (ANXA10) (NM_007193) Human Recombinant Protein
CAT#: TP300268
Recombinant protein of human annexin A10 (ANXA10)
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200268 protein sequence
Red=Cloning site Green=Tags(s) MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009124 |
Locus ID | 11199 |
UniProt ID | Q9UJ72 |
Cytogenetics | 4q32.3 |
Refseq Size | 1447 |
Refseq ORF | 972 |
Synonyms | ANX14 |
Summary | This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402103 | ANXA10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY402103 | Transient overexpression lysate of annexin A10 (ANXA10) |
USD 325.00 |
|
PH300268 | ANXA10 MS Standard C13 and N15-labeled recombinant protein (NP_009124) |
USD 2,055.00 |
|
TP720867 | Purified recombinant protein of Human annexin A10 (ANXA10) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review