IPP 2 (PPP1R2) (NM_006241) Human Mass Spec Standard

CAT#: PH300280

PPP1R2 MS Standard C13 and N15-labeled recombinant protein (NP_006232)

Product Images

Coomassie blue staining of purified PPP1R2 protein (Cat# TP300280). The protein was produced from HEK293T cells transfected with PPP1R2 cDNA clone (Cat# RC200280) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200280
• Predicted MW: 23 kDa
• Protein Sequence:
  Sequence Link

  >RC200280 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE
  PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF
  EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006232
• RefSeq Size: 3468
• RefSeq ORF: 615
• Synonyms: IPP-2; IPP2; PPP1R2A
• Locus ID: 5504
• UniProt ID: P41236
• Cytogenetics: 3q29
• Summary: 'Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human genome. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]'
• Protein Families: Druggable Genome