IPP 2 (PPP1R2) (NM_006241) Human Recombinant Protein

CAT#: TP300280

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2)

Product Images

Coomassie blue staining of purified PPP1R2 protein (Cat# TP300280). The protein was produced from HEK293T cells transfected with PPP1R2 cDNA clone (Cat# RC200280) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200280 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE
  PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF
  EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006232
• Locus ID: 5504
• UniProt ID: P41236
• Cytogenetics: 3q29
• Refseq Size: 3468
• Refseq ORF: 615
• Synonyms: IPP-2; IPP2; PPP1R2A
• Summary: Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human genome. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
• Protein Families: Druggable Genome