Aldolase C (ALDOC) (NM_005165) Human Mass Spec Standard
CAT#: PH300333
ALDOC MS Standard C13 and N15-labeled recombinant protein (NP_005156)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200333 |
Predicted MW | 39.5 kDa |
Protein Sequence |
>RC200333 protein sequence
Red=Cloning site Green=Tags(s) MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG GAAAQSLYIANHAY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005156 |
RefSeq Size | 1665 |
RefSeq ORF | 1092 |
Synonyms | ALDC |
Locus ID | 230 |
UniProt ID | P09972, A0A024QZ64 |
Cytogenetics | 17q11.2 |
Summary | 'This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417475 | ALDOC HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417475 | Transient overexpression lysate of aldolase C, fructose-bisphosphate (ALDOC) |
USD 396.00 |
|
TP300333 | Recombinant protein of human aldolase C, fructose-bisphosphate (ALDOC) |
USD 823.00 |
|
TP721085 | Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review