FAM32A (NM_014077) Human Mass Spec Standard
CAT#: PH300334
FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200334 |
Predicted MW | 13.2 kDa |
Protein Sequence |
>RC200334 protein sequence
Red=Cloning site Green=Tags(s) MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_054796 |
RefSeq Size | 1464 |
RefSeq ORF | 336 |
Synonyms | OTAG-12; OTAG12 |
Locus ID | 26017 |
UniProt ID | Q9Y421, A0A024R7I4 |
Cytogenetics | 19p13.11 |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415497 | FAM32A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415497 | Transient overexpression lysate of family with sequence similarity 32, member A (FAM32A) |
USD 396.00 |
|
TP300334 | Recombinant protein of human family with sequence similarity 32, member A (FAM32A) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review