FAM32A (NM_014077) Human Recombinant Protein
CAT#: TP300334
Recombinant protein of human family with sequence similarity 32, member A (FAM32A)
View other "FAM32A" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200334 protein sequence
Red=Cloning site Green=Tags(s) MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_054796 |
Locus ID | 26017 |
UniProt ID | Q9Y421, A0A024R7I4 |
Cytogenetics | 19p13.11 |
Refseq Size | 1464 |
Refseq ORF | 336 |
Synonyms | OTAG-12; OTAG12 |
Summary | Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415497 | FAM32A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415497 | Transient overexpression lysate of family with sequence similarity 32, member A (FAM32A) |
USD 396.00 |
|
PH300334 | FAM32A MS Standard C13 and N15-labeled recombinant protein (NP_054796) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review