FAM32A (NM_014077) Human Recombinant Protein

CAT#: TP300334

Recombinant protein of human family with sequence similarity 32, member A (FAM32A)

Product Images

Coomassie blue staining of purified FAM32A protein (Cat# TP300334). The protein was produced from HEK293T cells transfected with FAM32A cDNA clone (Cat# RC200334) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200334 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQE
  KRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054796
• Locus ID: 26017
• UniProt ID: Q9Y421, A0A024R7I4
• Cytogenetics: 19p13.11
• Refseq Size: 1464
• Refseq ORF: 336
• Synonyms: OTAG-12; OTAG12
• Summary: Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. May also increase cell sensitivity to apoptotic stimuli.[UniProtKB/Swiss-Prot Function]