MAPKAP Kinase 3 (MAPKAPK3) (NM_004635) Human Mass Spec Standard

CAT#: PH300358

MAPKAPK3 MS Standard C13 and N15-labeled recombinant protein (NP_004626)

Product Images

Coomassie blue staining of purified MAPKAPK3 protein (Cat# TP300358). The protein was produced from HEK293T cells transfected with MAPKAPK3 cDNA clone (Cat# RC200358) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200358
• Predicted MW: 43 kDa
• Protein Sequence:
  Sequence Link

  >RC200358 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLECFHRRTGQKC
  ALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMECMEGGELFSRIQERGDQAFTE
  REAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKDAVLKLTDFGFAKETTQNALQTPCYTPYYVA
  PEVLGPEKYDKSCDMWSLGVIMYILLCGFPPFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQL
  IRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVK
  IKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004626
• RefSeq Size: 2553
• RefSeq ORF: 1146
• Synonyms: 3PK; MAPKAP-K3; MAPKAP3; MAPKAPK-3; MDPT3; MK-3
• Locus ID: 7867
• UniProt ID: Q16644, A0A024R2W7
• Cytogenetics: 3p21.2
• Summary: This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2011]
• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway, VEGF signaling pathway