FCGRT (NM_004107) Human Mass Spec Standard
CAT#: PH300364
FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_004098)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200364 |
| Predicted MW | 39.6 kDa |
| Protein Sequence |
>RC200364 representing NM_004107
Red=Cloning site Green=Tags(s) MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA QDADLKDVNVIPATA myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_004098 |
| RefSeq Size | 1510 |
| RefSeq ORF | 1095 |
| Synonyms | alpha-chain; FCRN |
| Locus ID | 2217 |
| UniProt ID | P55899, A0A024QZI2 |
| Cytogenetics | 19q13.33 |
| Summary | 'This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]' |
| Protein Families | Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401327 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427768 | FCGRT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401327 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
USD 436.00 |
|
| LY427768 | Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 |
USD 436.00 |
|
| PH327329 | FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491) |
USD 2,055.00 |
|
| TP300364 | Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1 |
USD 823.00 |
|
| TP327329 | Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
USD 748.00 |
|
| TP721216 | Purified recombinant protein of Human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China