FCGRT (NM_001136019) Human Mass Spec Standard

CAT#: PH327329

FCGRT MS Standard C13 and N15-labeled recombinant protein (NP_001129491)

Product Images

Coomassie blue staining of purified FCGRT protein (Cat# TP327329). The protein was produced from HEK293T cells transfected with FCGRT cDNA clone (Cat# RC227329) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227329
• Predicted MW: 39.6 kDa
• Protein Sequence:
  Sequence Link

  >RC227329 representing NM_001136019
  Red=Cloning site Green=Tags(s)
  
  MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP
  CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF
  MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR
  PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA
  GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA
  QDADLKDVNVIPATA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129491
• RefSeq ORF: 1095
• Synonyms: alpha-chain; FCRN
• Locus ID: 2217
• UniProt ID: P55899, A0A024QZI2
• Cytogenetics: 19q13.33
• Summary: 'This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]'
• Protein Families: Transmembrane