IGBP1 (NM_001551) Human Mass Spec Standard

CAT#: PH300387

IGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001542)

Product Images

Coomassie blue staining of purified IGBP1 protein (Cat# TP300387). The protein was produced from HEK293T cells transfected with IGBP1 cDNA clone (Cat# RC200387) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200387
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200387 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEE
  IASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTAN
  SSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIES
  IDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGAL
  PDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001542
• RefSeq Size: 1679
• RefSeq ORF: 1017
• Synonyms: ALPHA-4; IBP1
• Locus ID: 3476
• UniProt ID: P78318
• Cytogenetics: Xq13.1
• Summary: 'The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome