IGBP1 (NM_001551) Human Recombinant Protein
CAT#: TP300387
Recombinant protein of human immunoglobulin (CD79A) binding protein 1 (IGBP1)
View other "IGBP1" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200387 protein sequence
Red=Cloning site Green=Tags(s) MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEE IASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTAN SSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIES IDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGAL PDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001542 |
Locus ID | 3476 |
UniProt ID | P78318 |
Cytogenetics | Xq13.1 |
Refseq Size | 1679 |
Refseq ORF | 1017 |
Synonyms | ALPHA-4; alpha4; IBP1 |
Summary | The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400594 | IGBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400594 | Transient overexpression lysate of immunoglobulin (CD79A) binding protein 1 (IGBP1) |
USD 396.00 |
|
PH300387 | IGBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001542) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review